PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013620090.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 272aa    MW: 29023.3 Da    PI: 8.917
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013620090.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding29.22.1e-09348346
                     SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqk 46
                     +W+ e+d  + +a + +  +    W++Ia+ ++ g++ +q+k+++  
   XP_013620090.1  3 AWSREDDIAFERALASYTDEsedKWEKIAADVP-GKSVEQIKEHYEV 48
                     7*****************99*************.**********965 PP

2Myb_DNA-binding42.21.9e-13107151347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT++E+ l++ +  ++G+g+W++I+r +  +Rt+ q+ s+ qky
   XP_013620090.1 107 AWTEDEHRLFLLGLDKYGKGDWRSISRNFVVTRTPTQVASHAQKY 151
                      6*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129310.383154IPR017884SANT domain
SMARTSM007177.6E-7152IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-5256IPR009057Homeodomain-like
PfamPF002493.6E-8347IPR001005SANT/Myb domain
CDDcd001673.46E-9350No hitNo description
SuperFamilySSF466891.72E-10457IPR009057Homeodomain-like
PROSITE profilePS5129417.58199156IPR017930Myb domain
SuperFamilySSF466891.08E-16102157IPR009057Homeodomain-like
TIGRFAMsTIGR015572.3E-17104154IPR006447Myb domain, plants
SMARTSM007173.2E-10104154IPR001005SANT/Myb domain
PfamPF002492.4E-11107151IPR001005SANT/Myb domain
CDDcd001676.51E-10107152No hitNo description
Gene3DG3DSA:1.10.10.601.2E-10107150IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 272 aa     Download sequence    Send to blast
MTAWSREDDI AFERALASYT DESEDKWEKI AADVPGKSVE QIKEHYEVLV EDVSRIESGC  60
VPLPAYNSPR GGSGGGGDDG GSTKKGGNSH VGESKAKSDQ ERRKGIAWTE DEHRLFLLGL  120
DKYGKGDWRS ISRNFVVTRT PTQVASHAQK YFIRLNSMNK ERRRTSIHDI TSVGDAVVST  180
PQGPITGQNN NNNGSAGAVA GGGNKSAKQG VSQQPPPGPP VYGTPSIGPQ PVVGTPVSLP  240
APPHMAFAAP VPGSVVPQMP YTTMPRTPTA HR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A2e-164681175RADIALIS
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013620090.10.0PREDICTED: transcription factor DIVARICATA-like
RefseqXP_013675762.10.0PREDICTED: transcription factor DIVARICATA-like
SwissprotQ8S9H77e-58DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A0D3AI800.0A0A0D3AI80_BRAOL; Uncharacterized protein
STRINGBra028654.1-P1e-175(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM35562861
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08520.11e-127MYB family protein